PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G04370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 650aa    MW: 66493.5 Da    PI: 6.2339
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G04370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093694061954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  OGLUM12G04370.1 369 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 406
                      554459******************************88 PP

2BELL115.13.5e-37218289172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk+kLl++l+eV++rY+qy+ q+q v+++Fea+ag gsa+ YtslAl++iSr+FrcL+daia q+
  OGLUM12G04370.1 218 ERQELQMKKSKLLNMLDEVEQRYRQYHRQMQGVAAAFEAAAGAGSATTYTSLALRTISRQFRCLRDAIAAQV 289
                      79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-56150287IPR006563POX domain
PfamPF075268.1E-48155286IPR006563POX domain
PROSITE profilePS5007111.904347410IPR001356Homeobox domain
CDDcd000865.91E-13350411No hitNo description
SMARTSM003897.8E-10350414IPR001356Homeobox domain
SuperFamilySSF466893.68E-17351417IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28353416IPR009057Homeodomain-like
PfamPF059204.4E-18367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MAAYFTGGGA GTDVVQAAGT DGLQTLYLMN PSYVGFTDAA AAPGGGAAAA NMVFLNSAVS  60
TLTPASFGHH HQPTPAAQHF VGIPLQSGYN LWGPDATGGN DVSPPRHGAQ QQAPAAAGTS  120
AAAVSPVLSL SSREAAPPVT VAAAAVPGGT DQEKVVMRSR YLKAAQELLD EAVSVSKGAA  180
TAVKKKEDSE GGVSGGGGGA EDGGGSKSGA AAEMSTAERQ ELQMKKSKLL NMLDEVEQRY  240
RQYHRQMQGV AAAFEAAAGA GSATTYTSLA LRTISRQFRC LRDAIAAQVR AASRGLGEDC  300
GDDEGGGGGG RTTVGSRLRF IDHQLRQQRA MQQLGMVHAA AAGGAAGGGW RPQRGLPERA  360
VSVLRAWLFE HFLHPYPKDS DKVMLAKQTG LTRSQVSNWF INARVRLWKP MVEEMYAEET  420
KAKEEEEEEH DAAAAAAGDR GGVVEQAPSK PDDSAGIGMS SSSPAAAASR SVGVHAGDQH  480
AQASFYGGGG GGDDPFQCRI KKARTTTADE PAAAAAFHVS GEAAVSHREL LMKFTEAGGE  540
GVRTGHPHVN DDDDDVPGGA GGYSLFTAAQ YGHQFGSDHF AFAGHGGGGG GGVSLTLGLP  600
HGADQTPASF LMGAGAGSDG GGAPVTTAGY DMNMQSTKSL AAQLMRDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-17356414563Homeobox protein Meis2
4xrm_B1e-17356414563Homeobox protein Meis2
5bng_A9e-18356414159Homeobox protein Meis2
5bng_B9e-18356414159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1208440.0AK120844.1 Oryza sativa Japonica Group cDNA clone:J023022M14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619926.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1
TrEMBLA0A0E0BPB40.0A0A0E0BPB4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036589-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-80BEL1-like homeodomain 1